| General information | | DisProt: | DP00004_C002 | | Name: | Antibacterial protein LL-37 | | Synonym(s): | CAMP_HUMAN
| | First appeared in release: | Release 2.0 (02/14/2005) | | UniProt: | P49913 | | UniGene: | Hs.51120 | | SwissProt: | CAMP_HUMAN | | TrEMBL: | | | NCBI (GI): | 1706745 | | Source organism: | Homo sapiens (Human) | | Sequence length: | 37 | | Percent disordered: | 100% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
LLGDFFRKSK EKIGKEFKRI VQRIKDFLRN LVPRTES
|
| Functional narrative |
Human cathelicidin peptide with antibacterial properties.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered - Extended | | Name: | | | Location: | 134 - 170 | | Length: | 37 | | Region sequence: |
[LL-37, 37 aa] | | Modification type: | Engineered
| | PDB: | | | Structural/functional type: | Function arises via a disorder to order transition
| | Functional classes: | Unknown
| | Functional subclasses: | Unknown
| Detection methods:
- Circular dichroism (CD) spectroscopy, near-UV (298 K; pH: 6; magnesium sulfate (salt) 84 mM; sodium chloride (salt) 160 mM)
| References:
- Johansson J, Gudmundsson GH, Rottenberg ME, Berndt KD, Agerberth B. "Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37." J Biol Chem. 1998; 273(6): 3718-24. PubMed: 9452503
| Comments:The disordered region became significantly more disordered below pH 5. At pH of 2, it was completely disordered. At pH of 13, it adopted a helical structure.
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
