DP00060: Modification methylase PvuIIFASTA viewXML view

General information
DisProt:DP00060
Name:Modification methylase PvuII
Synonym(s):MTP2_PROVU
M.PvuII
N-4 cytosine-specific methyltransferase PvuII
N(4)-cytosine-specific DNA methylase
EC 2.1.1.113
First appeared in release:Release 1.0 (08/01/2003)
UniProt:P11409
UniGene: 
SwissProt: MTP2_PROVU
TrEMBL:  
NCBI (GI): 1709165
Source organism:Proteus vulgaris
Sequence length:323
Percent disordered:15%
Homologues: 


Native sequence

        10         20         30         40         50         60
         |          |          |          |          |          |
MLNFGKKPAY TTSNGSMYIG DSLELLESFP EESISLVMTS PPFALQRKKE YGNLEQHEYV - 60
DWFLSFAKVV NKKLKPDGSF VVDFGGAYMK GVPARSIYNF RVLIRMIDEV GFFLAEDFYW - 120
FNPSKLPSPI EWVNKRKIRV KDAVNTVWWF SKTEWPKSDI TKVLAPYSDR MKKLIEDPDK - 180
FYTPKTRPSG HDIGKSFSKD NGGSIPPNLL QISNSESNGQ YLANCKLMGI KAHPARFPAK - 240
LPEFFIRMLT EPDDLVVDIF GGSNTTGLVA ERESRKWISF EMKPEYVAAS AFRFLDNNIS - 300
EEKITDIYNR ILNGESLDLN SII

Region 2: 70-81 Region 1: 166-203

Map of ordered and disordered regions







Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.


Region 1
Type:Disordered
Name: 
Location:166 - 203
Length:38
Region sequence:

PYSDRMKKLIEDPDKFYTPKTRPSGHDIGKSFSKDNGG

Modification type: Complex
Native
PDB:  
Structural/functional type:  
Functional classes:  
Functional subclasses: Methylation
Detection methods:
  1. X-ray crystallography (beamline X12-C ; MarResearch imaging plate detector)

References:
  1. Gong W, O'Gara M, Blumenthal RM, Cheng X. "Structure of pvu II DNA-(cytosine N4) methyltransferase, an example of domain permutation and protein fold assignment." Nucleic Acids Res. 1997; 25(14): 2702-15. PubMed: 9207015

Comments:
 



Region 2
Type:Disordered
Name:P loop
Location:70 - 81
Length:12
Region sequence:

VNKKLKPDGSFV

Modification type: Complex
Native
PDB:  
Structural/functional type: Function arises via a disorder to order transition
Functional classes:  
Functional subclasses: Protein-DNA binding
Methylation
Detection methods:
  1. X-ray crystallography (beamline X12-C ; MarResearch imaging plate detector)

References:
  1. Gong W, O'Gara M, Blumenthal RM, Cheng X. "Structure of pvu II DNA-(cytosine N4) methyltransferase, an example of domain permutation and protein fold assignment." Nucleic Acids Res. 1997; 25(14): 2702-15. PubMed: 9207015

Comments:
 



References

  1. Gong W, O'Gara M, Blumenthal RM, Cheng X. "Structure of pvu II DNA-(cytosine N4) methyltransferase, an example of domain permutation and protein fold assignment." Nucleic Acids Res. 1997; 25(14): 2702-15. PubMed: 9207015



Comments


The SwissProt sequence is the long form of the protein(aa1-aa336). The disordered regions were found using the short form of the protein. (aa14-aa336)



The referenced paper has disordered region 1 as residues 179-216 and region 2 as residues 57-68. They used the short form of Modification methylase PvuII which has 13 less N-terminal residues and is numbered 14-336.



AV 6-28-2010 PubMed: 9207015


If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us.


Disprot-footer
Contact us