| Region 3 |
| Type: | Disordered |
| Name: | transactivation domain (TAD) |
| Location: | 1 - 143 |
| Length: | 143 |
| Region sequence: |
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAK |
| Modification type: | Engineered
Fragment
|
| PDB: | |
| Structural/functional type: | Function arises via a disorder to order transition |
| Functional classes: | Modification site
Molecular assembly
|
| Functional subclasses: | Transactivation (transcriptional activation)
Protein-protein binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (phosphate (buffer) 3 mM)
- Circular dichroism (CD) spectroscopy, far-UV (phosphate (buffer) 10 mM)
|
References:
- Fladvad M, Zhou K, Moshref A, Pursglove S, Safsten P, Sunnerhagen M. "N and C-terminal sub-regions in the c-Myc transactivation region and their joint role in creating versatility in folding and binding." J Mol Biol. 2005; 346(1): 175-89. PubMed: 15663936
- McEwan IJ, Dahlman-Wright K, Ford J, Wright AP. "Functional interaction of the c-Myc transactivation domain with the TATA binding protein: evidence for an induced fit model of transactivation domain folding." Biochemistry. 1996; 35(29): 9584-93. PubMed: 8755740
|
Comments:
|